DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and Ngb

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001281237.1 Gene:Ngb / 64242 MGIID:2151886 Length:155 Species:Mus musculus


Alignment Length:155 Identity:35/155 - (22%)
Similarity:65/155 - (41%) Gaps:16/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPL---EELSGNARFRAHA 62
            |...|.:||:::|.:...:|.:.|..:..:.|...||.|..|.:.....   |:...:..|..|.
Mouse     1 MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDCLSSPEFLDHI 65

  Fly    63 GRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVI----LDVLTAACSL 123
            .:::.|.|.::..:   .||..|:|..|.:...|....|...|::...|.:    |.:|......
Mouse    66 RKVMLVIDAAVTNV---EDLSSLEEYLTSLGRKHRAVGVRLSSFSVGSGTVGESLLYMLEKCLGP 127

  Fly   124 DESQA--ATWAKLVDHVYGIIFKAI 146
            |.:.|  ..|::|    ||.:.:|:
Mouse   128 DFTPATRTAWSRL----YGAVVQAM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 31/141 (22%)
NgbNP_001281237.1 Ngb 1..152 CDD:271272 35/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001809
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46458
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.