DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and Mb

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_067599.1 Gene:Mb / 59108 RGDID:620411 Length:154 Species:Rattus norvegicus


Alignment Length:136 Identity:30/136 - (22%)
Similarity:54/136 - (39%) Gaps:14/136 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKF-PFRDVPL-EELSGNARFRAHAG 63
            ::..|.|::...|..........|..:|...|...|..|||| .|:::.. ||:..:...:.|..
  Rat     3 LSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGC 67

  Fly    64 RIIRVFDESIQVLGQD-GDLEKLDEIWTKIAVSHIPRTVSKESYNQ-LKGVILDVLTAACSLD-- 124
            .::......::..||. .:::.|       |.||..:......|.: :..||:.||....|.|  
  Rat    68 TVLTALGTILKKKGQHAAEIQPL-------AQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFG 125

  Fly   125 -ESQAA 129
             ::|.|
  Rat   126 ADAQGA 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 28/128 (22%)
MbNP_067599.1 Globin-like 6..154 CDD:419671 30/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345922
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5376
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.