DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and cygb2

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_005166278.1 Gene:cygb2 / 554176 ZFINID:ZDB-GENE-060920-1 Length:225 Species:Danio rerio


Alignment Length:153 Identity:47/153 - (30%)
Similarity:74/153 - (48%) Gaps:12/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKF-PFRDV--PLEELSGNARFRAHAGRIIRVF 69
            :||.||....|:..|.|..||.:||..|||..:.| .|:|:  | ||:..:::.|.||.|::...
Zfish    72 IIKDTWARVYASCEDVGVTILIRFFVNFPSAKQYFSQFQDMEDP-EEMEKSSQLRKHARRVMNAI 135

  Fly    70 DESIQVLGQDGDLEKLDEIWTKIAVSH-IPRTVSKESYNQLKGVILDVLT---AACSLDESQAAT 130
            :..::.|   .|.||:..:...:..:| ....|....:..|.||||::|.   ..|...|.| .:
Zfish   136 NTVVENL---HDPEKVSSVLVLVGKAHAFKYKVEPIYFKILSGVILEILAEEFGECFTPEVQ-TS 196

  Fly   131 WAKLVDHVYGIIFKAIDDDGNAK 153
            |:||:..:|..|..|..:.|..|
Zfish   197 WSKLMAALYWHITGAYTEVGWVK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 43/139 (31%)
cygb2XP_005166278.1 Cygb 65..217 CDD:271275 45/149 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586894
Domainoid 1 1.000 47 1.000 Domainoid score I11999
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5391
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106718
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3499
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.