powered by:
Protein Alignment glob1 and F55B11.7
DIOPT Version :9
Sequence 1: | NP_001287343.1 |
Gene: | glob1 / 41930 |
FlyBaseID: | FBgn0027657 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001076690.2 |
Gene: | F55B11.7 / 4927011 |
WormBaseID: | WBGene00045060 |
Length: | 317 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 12/51 - (23%) |
Similarity: | 24/51 - (47%) |
Gaps: | 12/51 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 EKLDEIWTK----------IAVSHIPRTVSKESY--NQLKGVILDVLTAAC 121
:|:.||..| :|.:|....:.|::: |:|...:.|::|..|
Worm 265 KKVTEIAIKWAFWDVMPEIVASAHTLADLKKQNWDLNELPLNVFDMITRKC 315
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
glob1 | NP_001287343.1 |
Mb_like |
9..142 |
CDD:271266 |
12/51 (24%) |
F55B11.7 | NP_001076690.2 |
BTB |
170..256 |
CDD:197585 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3378 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.