DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and hbd

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001005089.1 Gene:hbd / 448665 XenbaseID:XB-GENE-5844531 Length:147 Species:Xenopus tropicalis


Alignment Length:145 Identity:30/145 - (20%)
Similarity:56/145 - (38%) Gaps:27/145 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAIL--------TQ-FFNRFPSNLEKFPFRDVPLEELSGNA 56
            :::||...|...|: .|....|...|:.        || :|:.| .||..       :..:||||
 Frog     4 LSADEKSAINAVWQ-KVDIEKDGHEALTRLLVVYPWTQRYFSSF-GNLSN-------VTAISGNA 59

  Fly    57 RFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRT-VSKESYNQLKGVILDVLTA- 119
            :...|..:::...||:|.      .::.:....:.::..|.... |..|::.:|..|:..|:.. 
 Frog    60 KVHGHGKKVLSAVDEAIH------HIDDIKHFLSALSKKHAQELHVDPENFKRLADVLAIVVAGK 118

  Fly   120 -ACSLDESQAATWAK 133
             ..:......|.|.|
 Frog   119 LGTAFTPQVQAAWEK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 28/137 (20%)
hbdNP_001005089.1 Hb-beta-like 8..146 CDD:381262 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5213
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.