DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and cygb

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001006870.1 Gene:cygb / 448640 XenbaseID:XB-GENE-987724 Length:179 Species:Xenopus tropicalis


Alignment Length:157 Identity:47/157 - (29%)
Similarity:77/157 - (49%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPS---NLEKFPFRDVPLEELSGNARFRAHA 62
            :...|..:||:||....|...|.|.:||.:||..|||   :..:|...:.|| |:.|:.:.|.||
 Frog    19 ITESERGVIKETWARVYANCEDVGVSILIRFFVNFPSAKQHFSQFKHMEDPL-EMEGSVQLRKHA 82

  Fly    63 GRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSH-IPRTVSKESYNQLKGVILDVLTAACSLD-- 124
            .|::...:..::.|   ||.||:..:.:.:..|| :...|....:..|.||:|:|:....:.|  
 Frog    83 RRVMGAVNSVVENL---GDPEKITTVLSIVGKSHALKHKVDPVYFKILTGVMLEVIAEEYAKDFT 144

  Fly   125 -ESQAATWAKLVDHVYGIIFKAIDDDG 150
             :.|.| |.||..|:|..:..|..:.|
 Frog   145 PDVQLA-WNKLRSHLYSHVLSAYKEAG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 44/139 (32%)
cygbNP_001006870.1 Cygb 19..171 CDD:271275 47/157 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11724
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5213
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto103877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.