powered by:
Protein Alignment glob1 and glob3
DIOPT Version :9
Sequence 1: | NP_001287343.1 |
Gene: | glob1 / 41930 |
FlyBaseID: | FBgn0027657 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649597.3 |
Gene: | glob3 / 40726 |
FlyBaseID: | FBgn0037385 |
Length: | 196 |
Species: | Drosophila melanogaster |
Alignment Length: | 61 |
Identity: | 15/61 - (24%) |
Similarity: | 26/61 - (42%) |
Gaps: | 5/61 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 IKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVF 69
:::.|.:........|..:...|.|.:...::| ||:. .||:..| ..:||.|.|..|
Fly 44 LRQAWNLVRPFERRYGQDVFYSFLNDYYWGIKK--FRNG--AELNVKA-LHSHALRFINFF 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.