DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and glb-19

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001255496.1 Gene:glb-19 / 3565034 WormBaseID:WBGene00010146 Length:223 Species:Caenorhabditis elegans


Alignment Length:140 Identity:30/140 - (21%)
Similarity:53/140 - (37%) Gaps:13/140 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFP-FRDVPLEELSGNARFRAHAGRIIR 67
            :|...::.:|.:...........|....||:.|.....|| .:.|..:....|..|...|.|.::
 Worm    31 EEKNDLEHSWNLVEGKKNHIACDIYEMIFNQCPEARRLFPKLKFVGSKPDRKNNEFAFQAMRFMQ 95

  Fly    68 VFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAACSLDESQAATWA 132
            |.:.:::.|..   |..||.|...:...|....|:.:..:....|.|:     ||:...:.|...
 Worm    96 VIEGAVKALDH---LTSLDVILDNLGRRHGKLEVNGKFRSYYWSVFLE-----CSIYCLRHAFSK 152

  Fly   133 KL----VDHV 138
            ::    ||||
 Worm   153 RMNDKEVDHV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 29/135 (21%)
glb-19NP_001255496.1 Mb-like 36..177 CDD:381254 29/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46458
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.