DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and hbbe3

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001015058.1 Gene:hbbe3 / 30596 ZFINID:ZDB-GENE-980526-287 Length:147 Species:Danio rerio


Alignment Length:97 Identity:15/97 - (15%)
Similarity:40/97 - (41%) Gaps:19/97 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPR-TVSKESYNQLKGVI 113
            |.:..|.:.:||...:::..::::      .:::.:...:..::..|..: .|...::.    ::
Zfish    53 EAIMANPKVKAHGVVVLKGLEKAL------NNMDNIKSTYASLSELHSEKLQVDPGNFR----LL 107

  Fly   114 LDVLTAACS-------LDESQAATWAKLVDHV 138
            .|.||...:       ..:.||| |.|.:..|
Zfish   108 ADCLTVVIATRMRSEFTPDIQAA-WQKFLSVV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 15/97 (15%)
hbbe3NP_001015058.1 Hb-beta_like 7..146 CDD:271276 15/97 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.