DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and HBE1

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_005321.1 Gene:HBE1 / 3046 HGNCID:4830 Length:147 Species:Homo sapiens


Alignment Length:113 Identity:29/113 - (25%)
Similarity:53/113 - (46%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAV 94
            :||:.| .||..      | ..:.||.:.:||..:::..|.::|:      :::.|...:.|::.
Human    41 RFFDSF-GNLSS------P-SAILGNPKVKAHGKKVLTSFGDAIK------NMDNLKPAFAKLSE 91

  Fly    95 SHIPRT-VSKESYNQLKGVILDVLTAACSLD---ESQAATWAKLVDHV 138
            .|..:. |..|::..|..|::.:|......:   |.||| |.|||..|
Human    92 LHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAA-WQKLVSAV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 29/113 (26%)
HBE1NP_005321.1 Hb-beta-like 8..146 CDD:381262 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5488
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.