DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and HBA2

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_000508.1 Gene:HBA2 / 3040 HGNCID:4824 Length:142 Species:Homo sapiens


Alignment Length:133 Identity:27/133 - (20%)
Similarity:48/133 - (36%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRI-------I 66
            :|..|....|...:.||..|.:.|..||:....||..|:.    .|:|:.:.|..::       :
Human    11 VKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLS----HGSAQVKGHGKKVADALTNAV 71

  Fly    67 RVFDESIQVLGQDGDLE----KLDEIWTKI--------AVSHIPRTVSKESYNQLKGVILDVLTA 119
            ...|:....|....||.    ::|.:..|:        ..:|:|...:...:..|...:..|.|.
Human    72 AHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTV 136

  Fly   120 ACS 122
            ..|
Human   137 LTS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 27/133 (20%)
HBA2NP_000508.1 Hb-alpha-like 3..142 CDD:381263 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152411
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5488
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.