powered by:
Protein Alignment glob1 and Hba-a3
DIOPT Version :9
Sequence 1: | NP_001287343.1 |
Gene: | glob1 / 41930 |
FlyBaseID: | FBgn0027657 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013875.1 |
Gene: | Hba-a3 / 287167 |
RGDID: | 1359209 |
Length: | 142 |
Species: | Rattus norvegicus |
Alignment Length: | 65 |
Identity: | 15/65 - (23%) |
Similarity: | 28/65 - (43%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRI 65
::.::...|||.|........:.||..:.:.|..|||:...||. .....|:.:.:||..::
Rat 3 LSEEDKNNIKKAWVKIGNHAAEIGAETIGRLFIVFPSSKTYFPH----FNTSEGSDQVKAHGKKV 63
Fly 66 65
Rat 64 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166345927 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3378 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
50 |
1.000 |
Inparanoid score |
I5376 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.790 |
|
Return to query results.
Submit another query.