DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and SPAC869.02c

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_595017.1 Gene:SPAC869.02c / 2542104 PomBaseID:SPAC869.02c Length:427 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:31/152 - (20%)
Similarity:55/152 - (36%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNL-EKFPFRDVPLEELSGNARFRAHAGR 64
            :|..:.|.|:.:  ||:.  ..||..:...|:.:...|. |..|:.:...:......|..|.|  
pombe    31 LNESQKQYIRSS--IPIL--ESSGVNLTKAFYQKMLGNYPEVLPYFNKAHQISLSQPRILAFA-- 89

  Fly    65 IIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAACSLDESQAA 129
             :..:.::|.      ||..|.....:|.|.|:...:..|.|..:...:|..:......|.:..|
pombe    90 -LLNYAKNID------DLTSLSAFMDQIVVKHVGLQIKAEHYPIVGHCLLSTMQELLPSDVATPA 147

  Fly   130 ---TWAKLVDHVYGIIFKAIDD 148
               .|..    .||.:.|.:.|
pombe   148 FLEAWTT----AYGNLAKILID 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 27/136 (20%)
SPAC869.02cNP_595017.1 Hmp 30..179 CDD:223948 31/152 (20%)
PRK13289 31..424 CDD:237337 31/152 (20%)
flavohem_like_fad_nad_binding 175..424 CDD:99781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001809
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.