DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and cygb1

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_694484.1 Gene:cygb1 / 246090 ZFINID:ZDB-GENE-020513-1 Length:174 Species:Danio rerio


Alignment Length:146 Identity:44/146 - (30%)
Similarity:77/146 - (52%) Gaps:11/146 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFP-FRDV--PLEELSGNARFRAHA 62
            :..::|.:|:.||:...|...::|.|:|.:||..|||..:.|. ||::  | .|:..||:.:.|.
Zfish    16 LTEEDVCVIQDTWKPVYAERDNAGVAVLVRFFTNFPSAKQYFEHFRELQDP-AEMQQNAQLKKHG 79

  Fly    63 GRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPR-TVSKESYNQLKGVILDVLTAA---CSL 123
            .|::...:..::.|   .|.:||:.|:.::..||..| .|....:..|.||||:||..|   |..
Zfish    80 QRVLNALNTLVENL---RDADKLNTIFNQMGKSHALRHKVDPVYFKILAGVILEVLVEAFPQCFS 141

  Fly   124 DESQAATWAKLVDHVY 139
            .....::|:||:..:|
Zfish   142 PAEVQSSWSKLMGILY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 43/138 (31%)
cygb1NP_694484.1 Globin 14..165 44/146 (30%)
Cygb 16..169 CDD:271275 44/146 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586895
Domainoid 1 1.000 47 1.000 Domainoid score I11999
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5391
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto39544
orthoMCL 1 0.900 - - OOG6_106718
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.