DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and Hbb

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_150237.1 Gene:Hbb / 24440 RGDID:2783 Length:147 Species:Rattus norvegicus


Alignment Length:101 Identity:23/101 - (22%)
Similarity:44/101 - (43%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PTDSGAAILTQFFNRFPSNLEKF-PFRDV-PLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDL 82
            |.|.|...|.:....:|.....| .|.|: ....:.||.:.:||..::|..|::.::      .|
  Rat    21 PDDVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVINAFNDGLK------HL 79

  Fly    83 EKLDEIWTKIAVSHIPRT-VSKESYNQLKGVILDVL 117
            :.|...:..::..|..:. |..|::..|..:|:.||
  Rat    80 DNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 23/101 (23%)
HbbNP_150237.1 Hb-beta_like 7..146 CDD:271276 23/101 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.