DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and glb-20

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_510267.2 Gene:glb-20 / 187506 WormBaseID:WBGene00010970 Length:349 Species:Caenorhabditis elegans


Alignment Length:163 Identity:35/163 - (21%)
Similarity:58/163 - (35%) Gaps:69/163 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRII-RVFDES------IQVLGQDGD 81
            |..|:||.|..             |..|.         |.::: |:|::.      |..||::..
 Worm   100 GREIITQCFEN-------------PHSEF---------ANKVVQRIFEKREDYQKYIMNLGKERS 142

  Fly    82 L---EKLDEIWTKIAVSHIP-----RTVSKESYNQ-----------------------LKGVILD 115
            .   .:|.::...| |:||.     .:|||: |.:                       |:|||||
 Worm   143 SIVNNRLKQLVEDI-VAHIHDADFIESVSKQ-YGEEHVELKQYGFKPDFWVAVADAMTLEGVILD 205

  Fly   116 VLTAACSLDESQAATWAKLVDHVYGIIFKAIDD 148
            :   |........:.|:.||.    :||.::.|
 Worm   206 M---ANHQPADTVSAWSSLVT----MIFSSVRD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 32/155 (21%)
glb-20NP_510267.2 Mb_like 108..229 CDD:271266 30/151 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.