DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and glb-16

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_509275.2 Gene:glb-16 / 185848 WormBaseID:WBGene00018486 Length:379 Species:Caenorhabditis elegans


Alignment Length:155 Identity:28/155 - (18%)
Similarity:53/155 - (34%) Gaps:40/155 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKKTWEIPVATPTDSGAA----ILTQFFNRFPSNLEKFPFRDVPLEEL-------SGNARFRAHA 62
            |:.||.   ...|.:|..    :..:.|::...||..  .||:....:       ...:..|.|:
 Worm   126 IRFTWH---RLQTRNGGKRVENVFEEVFDKLVKNLPN--IRDMFSTRMFLCAMSRGTTSTLRDHS 185

  Fly    63 GRIIRVFDESI-------------------QVLGQDGDLEK----LDEIWTKIAVSHIPRTVSKE 104
            ...:::.|..|                   :|:|:...:.|    ....|.|.....|...:::|
 Worm   186 KNCVKMIDSVIKNFDVEKSKRTDTSSENDPRVIGRAHSILKPYGLAGNYWEKFGEVMIDVVLAQE 250

  Fly   105 SYNQLKGV-ILDVLTAACSLDESQA 128
            :...|.|. ...|:..||.:|:.:|
 Worm   251 AVRDLPGAGQAWVIFTACLVDQMRA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 28/155 (18%)
glb-16NP_509275.2 Mb_like 126..273 CDD:271266 27/151 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.