DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and glb-13

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_510079.2 Gene:glb-13 / 184697 WormBaseID:WBGene00008957 Length:282 Species:Caenorhabditis elegans


Alignment Length:164 Identity:31/164 - (18%)
Similarity:47/164 - (28%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIKKTWEIPVATPTDS-GAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDE 71
            |::::|.....|..|. |:.|........|.....|....:|...|..:.|||.||....:..|.
 Worm   108 LLEQSWRKTRKTGADHIGSKIFFMVLTAQPDIKAIFGLEKIPTGRLKYDPRFRQHALVYTKTLDF 172

  Fly    72 SIQVLGQDGDLEKLDE-----------------IWTKIAVSHIPRTVSKESYNQLKGVILDVLTA 119
            .|:.|...|.||...|                 .|...|.......|..|:..|           
 Worm   173 VIRNLDYPGKLEVYFENLGKRHVAMQGRGFEPGYWETFAECMTQAAVEWEANRQ----------- 226

  Fly   120 ACSLDESQAATWAKLVDHVYGIIFKAIDDDGNAK 153
                 ......|..|:..:...:.:..|::...|
 Worm   227 -----RPTLGAWRNLISCIISFMRRGFDEENGKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 28/150 (19%)
glb-13NP_510079.2 Mb-like 109..244 CDD:381254 28/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.