DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and glb-7

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_500166.3 Gene:glb-7 / 177008 WormBaseID:WBGene00016024 Length:278 Species:Caenorhabditis elegans


Alignment Length:139 Identity:23/139 - (16%)
Similarity:53/139 - (38%) Gaps:27/139 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRII 66
            :.:|..:::::|::.......:...|....||:.|...:.|||........|....|  ||.|.:
 Worm     8 SQEEKDILRRSWKVLDKNLNHTAYNIFEMIFNQSPDTRQLFPFMKFNTGGRSKEIEF--HALRFM 70

  Fly    67 RVFDESIQVLGQDGDLEKLDE---------------------IWTKIAVSHIPRTVSKESY---- 106
            :|.:..::.|.....|..|.:                     ::.:..:.|..:.:.:::|    
 Worm    71 QVLESVVKTLDNPETLNPLCDNLGRVHGRLSESRGFRTHHWGVFIECTLFHFRKVLGQDTYFHRM 135

  Fly   107 NQLKGVILD 115
            :.|..||::
 Worm   136 DALDKVIIN 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 22/132 (17%)
glb-7NP_500166.3 Mb-like 15..156 CDD:381254 22/132 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46458
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.