DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and Cygb

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_570100.1 Gene:Cygb / 170520 RGDID:69415 Length:190 Species:Rattus norvegicus


Alignment Length:157 Identity:44/157 - (28%)
Similarity:73/157 - (46%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPS---NLEKFPFRDVPLEELSGNARFRAHA 62
            ::..|.:.::.||....|...|.|.|||.:||..|||   ...:|...:.|| |:..:.:.|.||
  Rat    19 LSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL-EMERSPQLRKHA 82

  Fly    63 GRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSH-IPRTVSKESYNQLKGVILDVLTAACSLD-- 124
            .|::...:..::.|   .|.:|:..:...:..:| :...|....:..|.||||||:....:.|  
  Rat    83 CRVMGALNTVVENL---HDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILDVIAEEFANDFP 144

  Fly   125 -ESQAATWAKLVDHVYGIIFKAIDDDG 150
             |:|.| |.||...:|..:..|..:.|
  Rat   145 VETQKA-WTKLRGLIYSHVTAAYKEVG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 41/139 (29%)
CygbNP_570100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 0/1 (0%)
Globin 17..167 43/152 (28%)
Cygb 22..171 CDD:271275 44/154 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5376
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto97187
orthoMCL 1 0.900 - - OOG6_106718
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.