DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and Hbb-y

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_032247.1 Gene:Hbb-y / 15135 MGIID:96027 Length:147 Species:Mus musculus


Alignment Length:146 Identity:39/146 - (26%)
Similarity:61/146 - (41%) Gaps:29/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDEVQLIKKTWEIPVATPTDSGAAI---------LTQFFNRFPSNLEKFPFRDVPLEELSGNARF 58
            ::|..||...|. .|......|.|:         ..:||:.| .||..       ...:.||.|.
Mouse     6 AEEKTLINGLWS-KVNVEEVGGEALGRLLVVYPWTHRFFDSF-GNLSS-------ASAIMGNPRV 61

  Fly    59 RAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRT-VSKESYNQLKGVILDVLTAACS 122
            :||..:::..|.|||:      :|:.|.....|::..|..:. |..|::..|..|::.||.:...
Mouse    62 KAHGKKVLTAFGESIK------NLDNLKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFG 120

  Fly   123 LD---ESQAATWAKLV 135
            .:   |.||| |.|||
Mouse   121 NEFTAEMQAA-WQKLV 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 37/140 (26%)
Hbb-yNP_032247.1 Hb-beta_like 7..146 CDD:271276 39/145 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5464
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.