DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and Cygb

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_084482.1 Gene:Cygb / 114886 MGIID:2149481 Length:190 Species:Mus musculus


Alignment Length:157 Identity:46/157 - (29%)
Similarity:76/157 - (48%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKF-PFRDV--PLEELSGNARFRAHA 62
            ::..|.:.::.||....|...|.|.|||.:||..|||..:.| .||.:  || |:..:.:.|.||
Mouse    19 LSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFRHMEDPL-EMERSPQLRKHA 82

  Fly    63 GRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSH-IPRTVSKESYNQLKGVILDVLTAACSLD-- 124
            .|::...:..::.|   .|.:|:..:...:..:| :...|....:..|.||||:|:....:.|  
Mouse    83 CRVMGALNTVVENL---HDPDKVSSVLALVGKAHALKHKVEPMYFKILSGVILEVIAEEFANDFP 144

  Fly   125 -ESQAATWAKLVDHVYGIIFKAIDDDG 150
             |:|.| ||||...:|..:..|..:.|
Mouse   145 VETQKA-WAKLRGLIYSHVTAAYKEVG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 43/139 (31%)
CygbNP_084482.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 0/1 (0%)
Globin 17..167 45/152 (30%)
Cygb 22..171 CDD:271275 46/154 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5464
Isobase 1 0.950 - 0 Normalized mean entropy S6486
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto93645
orthoMCL 1 0.900 - - OOG6_106718
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3499
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.