DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and CYGB

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_005257062.1 Gene:CYGB / 114757 HGNCID:16505 Length:202 Species:Homo sapiens


Alignment Length:157 Identity:43/157 - (27%)
Similarity:73/157 - (46%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPS---NLEKFPFRDVPLEELSGNARFRAHA 62
            ::..|.:.::..|....|...|.|.|||.:||..|||   ...:|...:.|| |:..:.:.|.||
Human    19 LSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL-EMERSPQLRKHA 82

  Fly    63 GRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSH-IPRTVSKESYNQLKGVILDVLTAACSLD-- 124
            .|::...:..::.|   .|.:|:..:...:..:| :...|....:..|.||||:|:....:.|  
Human    83 CRVMGALNTVVENL---HDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFP 144

  Fly   125 -ESQAATWAKLVDHVYGIIFKAIDDDG 150
             |:|.| ||||...:|..:..|..:.|
Human   145 PETQRA-WAKLRGLIYSHVTAAYKEVG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 40/139 (29%)
CYGBXP_005257062.1 Cygb 22..171 CDD:271275 43/154 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5488
Isobase 1 0.950 - 0 Normalized mean entropy S6486
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1379813at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto90069
orthoMCL 1 0.900 - - OOG6_106718
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3499
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.