DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment glob1 and Hbb-bt

DIOPT Version :9

Sequence 1:NP_001287343.1 Gene:glob1 / 41930 FlyBaseID:FBgn0027657 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_032246.2 Gene:Hbb-bt / 101488143 MGIID:5474850 Length:147 Species:Mus musculus


Alignment Length:132 Identity:29/132 - (21%)
Similarity:52/132 - (39%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKF-PFRDV-PLEELSGNARFRAHAG 63
            :|:|||                 |...|.:....:|.....| .|.|: ....:.|||:.:||..
Mouse    19 VNADEV-----------------GGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKVKAHGK 66

  Fly    64 RIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRT-VSKESYNQLKGVILDVLTAACSLDESQ 127
            ::|..|::.:      ..|:.|...:..::..|..:. |..|::..|..:|:.||......|.:.
Mouse    67 KVITAFNDGL------NHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTP 125

  Fly   128 AA 129
            ||
Mouse   126 AA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glob1NP_001287343.1 Mb_like 9..142 CDD:271266 25/124 (20%)
Hbb-btNP_032246.2 Hb-beta_like 7..146 CDD:271276 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842473
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3378
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.