DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14877 and Phlpp1

DIOPT Version :9

Sequence 1:	NP_650507.1	Gene:	CG14877 / 41929	FlyBaseID:	FBgn0038380	Length:	254	Species:	Drosophila melanogaster
Sequence 2:	NP_598582.3	Gene:	Phlpp1 / 98432	MGIID:	2138327	Length:	1687	Species:	Mus musculus

Alignment Length:	108	Identity:	28/108 - (25%)
Similarity:	47/108 - (43%)	Gaps:	27/108 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 EAICDANGRNC--TIRALVLLPDDNMYQASLPRVLPILKVAEQQIR-SKSLIPSHIDFEWLAHDT 91
            :.:|.|.  ||  |:|...|            |.:|.:|..:.::. .:.|:...:||  :.|.|
Mouse   742 DKLCMAG--NCVETLRLQAL------------RRMPHIKHVDLRLNILRKLMADEVDF--VQHVT 790

  Fly    92 KCDA---SLGVIKAM--DGI-IKQCA--QVIFGPVCDYSLAAV 126
            :.|.   .||.:.||  :.| :..|.  |::...||.|.|.|:
Mouse   791 QLDLRDNKLGDLDAMIFNNIEVLHCERNQLVTLNVCGYFLKAL 833

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14877	NP_650507.1	Periplasmic_Binding_Protein_Type_1	46..>241	CDD:299141	22/90 (24%)
Phlpp1	NP_598582.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..96
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	230..406
		PH_PHLPP-like	491..587	CDD:270131
		PH	511..592	CDD:278594
		LRR_RI	581..885	CDD:238064	28/108 (26%)
		LRR_8	594..659	CDD:290566
		LRR 1	594..615
		leucine-rich repeat	597..617	CDD:275380
		LRR 2	617..638
		leucine-rich repeat	618..648	CDD:275380
		LRR_8	647..726	CDD:290566
		LRR 3	648..669
		LRR 4	671..692
		leucine-rich repeat	672..694	CDD:275380
		LRR 5	694..715
		leucine-rich repeat	695..717	CDD:275380
		LRR 6	717..739
		leucine-rich repeat	718..740	CDD:275380
		LRR 7	740..760		7/31 (23%)
		leucine-rich repeat	741..764	CDD:275380	8/35 (23%)
		LRR 8	764..785		2/20 (10%)
		LRR_RI	768..1030	CDD:238064	18/68 (26%)
		leucine-rich repeat	768..788	CDD:275380	3/21 (14%)
		LRR 9	788..809		7/20 (35%)
		leucine-rich repeat	789..809	CDD:275380	6/19 (32%)
		leucine-rich repeat	810..851	CDD:275380	8/24 (33%)
		LRR 10	829..850		2/5 (40%)
		LRR 11	851..872
		leucine-rich repeat	852..874	CDD:275380
		LRR 12	874..895
		leucine-rich repeat	875..897	CDD:275380
		LRR_8	896..954	CDD:290566
		LRR 13	897..918
		leucine-rich repeat	898..919	CDD:275380
		LRR 14	919..940
		leucine-rich repeat	920..943	CDD:275380
		LRR 15	943..964
		leucine-rich repeat	944..967	CDD:275380
		LRR 16	969..989
		LRR_8	970..1028	CDD:290566
		leucine-rich repeat	970..993	CDD:275380
		LRR 17	993..1014
		leucine-rich repeat	994..1017	CDD:275380
		LRR 18	1017..1038
		LRR 19	1040..1061
		LRR 20	1062..1083
		leucine-rich repeat	1063..1085	CDD:275380
		LRR 21	1085..1106
		PP2Cc	1124..1376	CDD:214625
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1414..1465
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1604..1687
		PDZ-binding	1685..1687
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900