DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14877 and CYR1

DIOPT Version :9

Sequence 1:	NP_650507.1	Gene:	CG14877 / 41929	FlyBaseID:	FBgn0038380	Length:	254	Species:	Drosophila melanogaster
Sequence 2:	NP_012529.3	Gene:	CYR1 / 853452	SGDID:	S000003542	Length:	2026	Species:	Saccharomyces cerevisiae

Alignment Length:	78	Identity:	20/78 - (25%)
Similarity:	30/78 - (38%)	Gaps:	10/78 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 VATCREEPARDCEAICDANGRNCT--IRALVLLPDDNMYQASLPRV----LPILKVAEQQ----I 72
            |||.:.....|.:.:||....|.|  :||...|.|..|.......:    |.:.:..:||    :
Yeast  1572 VATHKLWEYMDVDTVCDIARENSTDPLRAAAELKDHAMAYGCTENITILCLALYENIQQQNRFTL 1636

  Fly    73 RSKSLIPSHIDFE 85
            ...||:.....||
Yeast  1637 NKNSLMTRRSTFE 1649

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14877	NP_650507.1	Periplasmic_Binding_Protein_Type_1	46..>241	CDD:299141	10/48 (21%)
CYR1	NP_012529.3	Ad_cyc_g-alpha	368..418	CDD:369912
		RA_PHLPP_like	678..776	CDD:340473
		PLN00113	792..>1273	CDD:215061
		leucine-rich repeat	796..817	CDD:275380
		leucine-rich repeat	818..839	CDD:275380
		leucine-rich repeat	840..864	CDD:275380
		leucine-rich repeat	865..887	CDD:275380
		leucine-rich repeat	888..910	CDD:275380
		leucine-rich repeat	911..933	CDD:275380
		leucine-rich repeat	934..956	CDD:275380
		leucine-rich repeat	957..978	CDD:275380
		leucine-rich repeat	979..1018	CDD:275380
		leucine-rich repeat	1019..1041	CDD:275380
		leucine-rich repeat	1042..1065	CDD:275380
		leucine-rich repeat	1066..1088	CDD:275380
		leucine-rich repeat	1089..1111	CDD:275380
		leucine-rich repeat	1167..1187	CDD:275380
		leucine-rich repeat	1191..1211	CDD:275380
		leucine-rich repeat	1236..1258	CDD:275380
		leucine-rich repeat	1259..1287	CDD:275380
		PP2C	1374..1617	CDD:395385	13/44 (30%)
		CYCc	1613..1825	CDD:214485	7/37 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900