DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Adcy7

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_445848.1 Gene:Adcy7 / 84420 RGDID:619966 Length:1100 Species:Rattus norvegicus


Alignment Length:224 Identity:43/224 - (19%)
Similarity:77/224 - (34%) Gaps:68/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DNMYQASLPRVLPILKVAEQQIRSKS--------------LIPSHIDFEWLAHDTKCDAS---LG 98
            :|:.:..|..||| ..||...|..|:              :..|..||:  ...|:||.:   |.
  Rat   862 ENVNRLLLENVLP-AHVAAHFIGDKAAEDWYHQSYDCVCVMFASVPDFK--VFYTECDVNKEGLE 923

  Fly    99 VIKAMDGIIKQCAQVIFGPVCDYSLAAVSRI----TKYFNSQGTPLISVGGSTYDFEQKKTDCN- 158
            .::.::.||....:::..|    ..:.|.:|    :.|..:.|..:.| |....|.|:|..... 
  Rat   924 CLRLLNEIIADFDELLLKP----KFSGVEKIKTIGSTYMAAAGLSVPS-GHENQDLERKHVHIGV 983

  Fly   159 -DEFYMLLRTGM--LSFETISELTINVMKRHN----------------WSHSIFYYERDGQRSVA 204
             .||.|.|.:.:  ::..:.:...:.|...|.                |.:::....|       
  Rat   984 LVEFSMALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASR------- 1041

  Fly   205 GMHTCFLMMKSLGK----QMRNENMTFAQ 229
                    |:|.|:    |:..|..|..|
  Rat  1042 --------MESTGELGKIQVTEETCTILQ 1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 43/224 (19%)
Adcy7NP_445848.1 AC_N <21..251 CDD:318454
Guanylate_cyc 272..422 CDD:306677
DUF1053 487..593 CDD:399378
Guanylate_cyc 891..1087 CDD:306677 34/194 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.