DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Adcy2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_112269.2 Gene:Adcy2 / 81636 RGDID:619965 Length:1095 Species:Rattus norvegicus


Alignment Length:96 Identity:19/96 - (19%)
Similarity:35/96 - (36%) Gaps:29/96 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYS---------------LA 124
            ::::|:|:...:||...|.:....  ::.|     |..|:|..:.|:.               |.
  Rat   861 ENVLPAHVAEHFLARSLKNEELYH--QSYD-----CVCVMFASIPDFKEFYTESDVNKEGLECLR 918

  Fly   125 AVSRITKYFNS-------QGTPLISVGGSTY 148
            .::.|...|:.       .|...|...||||
  Rat   919 LLNEIIADFDDLLSKPKFSGVEKIKTIGSTY 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 19/96 (20%)
Adcy2NP_112269.2 AC_N <37..264 CDD:318454
Guanylate_cyc 285..469 CDD:306677
DUF1053 499..603 CDD:399378
Guanylate_cyc 882..1081 CDD:306677 14/75 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.