DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Gucy2g

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:106 Identity:20/106 - (18%)
Similarity:45/106 - (42%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SLPRVLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDY 121
            |:.|:...|:....::.|:.:...::.:|:...::.|.|...:...:|.:.|:....:|||.|..
Mouse    61 SVQRLGAGLQTVVDKLNSEPVGLGNVSWEFTYTNSTCSAKESLAVFIDQVQKEHISALFGPACPE 125

  Fly   122 SLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFY 162
            :...:..:...:|   .||       :||..:.....|.|:
Mouse   126 AAEVIGLLASEWN---IPL-------FDFVGQMAALKDHFW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 20/106 (19%)
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595 20/106 (19%)
PK_GC 555..829 CDD:270894
CYCc 865..1055 CDD:214485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.