DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Adcy5

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_072122.2 Gene:Adcy5 / 64532 RGDID:71014 Length:1262 Species:Rattus norvegicus


Alignment Length:79 Identity:19/79 - (24%)
Similarity:29/79 - (36%) Gaps:16/79 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVFGPKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDDNMYQASLPRVLPILKVAEQQIRS 74
            |:|...:.|..|...||...:.......|.| |:|.:....:|..|..|     :|         
  Rat   385 LIFSCTNIVGVCTHYPAEVSQRQAFQETREC-IQARLHSQRENQQQERL-----LL--------- 434

  Fly    75 KSLIPSHIDFEWLA 88
             |::|.|:..|..|
  Rat   435 -SVLPRHVAMEMKA 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 9/43 (21%)
Adcy5NP_072122.2 AC_N 1..459 CDD:318454 19/79 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..196
Guanylate_cyc 461..634 CDD:306677
DUF1053 669..761 CDD:399378
Guanylate_cyc 1063..1257 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.