DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and CG34357

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster


Alignment Length:255 Identity:56/255 - (21%)
Similarity:88/255 - (34%) Gaps:67/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVGLVFGPKDCVATCREEPARDCEAICDANGRNCTI--RALVLLPD---DNMYQA-SLP----R 60
            ||..||.|    :......|.|...|:   ..|||.:  |.::.:.|   ::.|:: .||    .
  Fly   866 LLTDLVRG----MRYLHTSPLRVHGAL---TSRNCVVDARWVLKITDYGLNSFYESQGLPPRTRS 923

  Fly    61 VLPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAA 125
            ...:|..|.:.:|:..|...|.....:...|:    ||.:.:. |||.|...|...|.|..||:.
  Fly   924 AKELLWTAPELLRNMKLHQHHHQHGRIQLGTQ----LGDVYSF-GIIMQEVVVRGEPYCMLSLSP 983

  Fly   126 VSRITKYFNSQGTPLI----SVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRH 186
            ...|.|.  .:..|||    |.|.:..:                             .||:| |.
  Fly   984 EEIIVKI--KKPPPLIRPSVSKGAAPPE-----------------------------AINIM-RQ 1016

  Fly   187 NWSHSIFYYERDGQRSVAGMHTCFLMMKSLGKQMRNENMTFAQFPLEPNLTNRTEEMRRE 246
            .|:.     :.|.:.....::..|.|:    ...|..|.....|.:....:|..||:.||
  Fly  1017 CWAE-----QPDMRPDFNSVYERFKML----NHGRKVNFVDTMFQMLEKYSNNLEELIRE 1067

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 40/206 (19%)
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 48/227 (21%)
CYCc 1074..1266 CDD:214485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.