DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and adcy3a

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_009290286.1 Gene:adcy3a / 571825 ZFINID:ZDB-GENE-111027-6 Length:1119 Species:Danio rerio


Alignment Length:192 Identity:36/192 - (18%)
Similarity:66/192 - (34%) Gaps:53/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SLPRVLPILKVAEQQIR-SKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGII---KQCAQVIFGP 117
            ||...|.:.:.::||.| ..|::|.||..|.| .|.|.:||...::..:.:.   .:...::|..
Zfish   261 SLEVKLNLEEQSQQQERLLLSILPKHIADEML-QDMKKEASQKEMQQFNTMYMYRHENVSILFAD 324

  Fly   118 VCDY----SLAAVSRITKYFNSQGTPL-----------ISVGGSTY-------DFEQKKTDCNDE 160
            :..:    |..:...:.|..|......           |.:.|..|       |:.:....|:  
Zfish   325 IVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAACS-- 387

  Fly   161 FYMLLRTGMLSFETISELTINVMKRHNWSHSIFYYERDGQRSV---AGMHTCFLMMKSLGKQ 219
                :..|:...|.||                 |.....|..|   .|:|:..::...||::
Zfish   388 ----IMMGLAMVEAIS-----------------YVREKTQTDVDMRVGVHSGTVLGGVLGQK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 36/192 (19%)
adcy3aXP_009290286.1 AC_N <37..304 CDD:292831 16/43 (37%)
CYCc 273..468 CDD:214485 33/180 (18%)
Guanylate_cyc 310..492 CDD:278633 20/142 (14%)
CYCc 858..1075 CDD:214485
Guanylate_cyc 889..1096 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.