DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and npr3

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:195 Identity:45/195 - (23%)
Similarity:84/195 - (43%) Gaps:29/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AICDANGR----NCTIRALVLLPDDNMYQASLPRVLPILKVAEQQIRSKSL---IPSHIDFEWLA 88
            |:....||    |..|..:|:||.:|.|..|..||.|.::.|::.:|....   :..::.||   
Zfish    13 AVLMVPGRTSALNDNIEVMVMLPRNNTYLFSYTRVFPAIEYAKKALREADAYAGLRFNVRFE--- 74

  Fly    89 HDTKC--DASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFE 151
             ::.|  ||...::   |....:...::.||||:|:.::|:|:..::|   .|:||.|.....|.
Zfish    75 -NSACGMDALYALV---DRQKDERPDLVLGPVCEYAASSVTRVASHWN---IPVISAGALATGFN 132

  Fly   152 QKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGMHTCFLMMKSL 216
            .|    ..|:..|.|... ::..::|....:.....|..:...|:.|...     ..|:..|:.:
Zfish   133 SK----TPEYSHLTRIAP-TYLKMAETFQAIFGHFGWRTAYLIYDDDKDE-----RNCYFTMEGV 187

  Fly   217  216
            Zfish   188  187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 40/176 (23%)
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 40/179 (22%)
ANF_receptor 46..389 CDD:279440 34/162 (21%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44755
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.