Sequence 1: | NP_650507.1 | Gene: | CG14877 / 41929 | FlyBaseID: | FBgn0038380 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005165413.1 | Gene: | npr3 / 569395 | ZFINID: | ZDB-GENE-060531-91 | Length: | 503 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 45/195 - (23%) |
---|---|---|---|
Similarity: | 84/195 - (43%) | Gaps: | 29/195 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 AICDANGR----NCTIRALVLLPDDNMYQASLPRVLPILKVAEQQIRSKSL---IPSHIDFEWLA 88
Fly 89 HDTKC--DASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFE 151
Fly 152 QKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGMHTCFLMMKSL 216
Fly 217 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14877 | NP_650507.1 | Periplasmic_Binding_Protein_Type_1 | 46..>241 | CDD:299141 | 40/176 (23%) |
npr3 | XP_005165413.1 | Periplasmic_Binding_Protein_Type_1 | 29..416 | CDD:299141 | 40/179 (22%) |
ANF_receptor | 46..389 | CDD:279440 | 34/162 (21%) | ||
TM_EphA1 | 436..468 | CDD:214014 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR44755 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.870 |