DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and adcy2a

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_692173.5 Gene:adcy2a / 563724 ZFINID:ZDB-GENE-061109-1 Length:1155 Species:Danio rerio


Alignment Length:150 Identity:27/150 - (18%)
Similarity:61/150 - (40%) Gaps:48/150 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KSLIPSHIDFEWLAHDTKCD--------------ASLGVIKAM--------DGIIKQCAQVIFGP 117
            ::::|:|:...:||.:.|.:              ||:...|..        :|:  :|.:::...
Zfish   921 ENVLPAHVAEHFLARNWKNEDLYHQSYDLVCVMFASIPDFKEFYTESDVNKEGL--ECLRLLNEI 983

  Fly   118 VCDY-SLAAVSRITKYFNSQGTPLISVGGSTY------------DFEQKKTDCNDEFYMLLRTGM 169
            :.|: .|.:..:.:      |...|...||||            ::.|:    :|..||.:.| |
Zfish   984 IADFDELLSKPKFS------GVEKIKTIGSTYMAATGLNATPGPEYTQE----HDRQYMHIGT-M 1037

  Fly   170 LSFETISELTINVMKRHNWS 189
            :.|.......::|:.:|:::
Zfish  1038 VEFAFALVGKLDVINKHSFN 1057

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 27/149 (18%)
adcy2aXP_692173.5 AC_N <92..319 CDD:292831
CYCc 295..498 CDD:214485
Guanylate_cyc 340..524 CDD:278633
DUF1053 554..658 CDD:283888
CYCc 912..1120 CDD:214485 27/149 (18%)
Guanylate_cyc 942..1141 CDD:278633 22/128 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.