DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and adcy6b

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002666536.2 Gene:adcy6b / 560807 ZFINID:ZDB-GENE-090127-2 Length:1174 Species:Danio rerio


Alignment Length:244 Identity:43/244 - (17%)
Similarity:91/244 - (37%) Gaps:76/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TIRALVLLPDDNMYQ---------ASLPRVLPILKVA----EQQIRSKSLIPSHIDFEWLAHDTK 92
            |:.||....:.|..|         .|:|.:|.:..:|    .||:.|    .:.:||.|....|:
Zfish   877 TVDALYAFNETNYCQETVTKVSLRVSIPVILTVFVLALYLHAQQVES----TARLDFLWKLQATE 937

  Fly    93 CDASLGVIKA-----MDGIIK----------------------QCAQVIFGPVCDYSLAAVSRIT 130
            ....:..::|     :..|:.                      :|..|:|        |::|..:
Zfish   938 EKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMF--------ASISNFS 994

  Fly   131 KYF-----NSQGTPLISVGGSTY-DFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWS 189
            :::     |::|...:.:..... ||::   ..::|.|..|       |.|..:....|.....:
Zfish   995 EFYTELEANNEGVECLRLLNEIIADFDE---IISEEKYKQL-------EKIKTIGSTYMAASGLN 1049

  Fly   190 HSIFYYERDGQRSVAGMHTCFLMMKSLGKQMR--NENMTFAQFPLEPNL 236
            .|.  |:::|:..:..:....:.::   :||:  ||: :|..|.::..|
Zfish  1050 DST--YDKEGRTHILALADYAMRLR---EQMKYINEH-SFNNFQMKIGL 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 40/239 (17%)
adcy6bXP_002666536.2 AC_N 15..376 CDD:318454
Guanylate_cyc 378..562 CDD:306677
DUF1053 590..677 CDD:310728
Guanylate_cyc 975..1169 CDD:306677 25/142 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.