DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and npr1a

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001038402.1 Gene:npr1a / 560653 ZFINID:ZDB-GENE-060503-539 Length:1067 Species:Danio rerio


Alignment Length:266 Identity:60/266 - (22%)
Similarity:108/266 - (40%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLVLLLVGLVFGPKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDDNM-YQASLPRVLPI 64
            :.|::||.|:.||..:.......:|.   .....|:.:|.|:  .|:||..|. |..:.|||.|.
Zfish    11 LTLLVLLSGVSFGVVELEPVPENQPQ---SPSAHASQKNITL--AVILPLHNTEYPWAWPRVGPA 70

  Fly    65 LKVAEQQIRS--KSLIPSHIDFEWLAHDTK---CDASLGVIKAMDGIIKQCAQVIFGPVCDYSLA 124
            |..|.:::.|  ..|...|:...:.:.:.|   |..|:..:.|:|...........||.||||.:
Zfish    71 LYWALEKVNSDPNLLAGYHLQLVFNSSENKEGLCSDSVAPLVAVDLKFSYNPWAFIGPGCDYSSS 135

  Fly   125 AVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNW- 188
            .|:|.|.::.   .|:|:.|.....|         ..|..:.....:.:.:.|..:.:.:...| 
Zfish   136 PVARFTTHWE---VPMITSGARALGF---------NLYSSITNIGPTHKKLGEFVLRMHRHFGWD 188

  Fly   189 SHSIFYY--ERDGQRSVAGMHTCFLMMKSLGKQMRNENMTFAQF-------PLEPNLTNRTEEMR 244
            .|::..:  .::..|      .|:..::....|||.:|:|....       ||      |.:|:.
Zfish   189 KHAMLMFNDNKNDDR------PCYFAVEGPYTQMREDNITADDLVFNEDEEPL------RYDELL 241

  Fly   245 REIGNK 250
            |:|.:|
Zfish   242 RDISHK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 46/210 (22%)
npr1aNP_001038402.1 PBP1_NPR_A 48..449 CDD:107380 51/226 (23%)
ANF_receptor 66..421 CDD:279440 44/206 (21%)
PK_GC-A_B 540..814 CDD:270944
TyrKc 554..808 CDD:197581
HNOBA <823..868 CDD:285003
CYCc 847..1032 CDD:214485
Guanylate_cyc 874..1060 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.