DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ADCY10

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_060887.2 Gene:ADCY10 / 55811 HGNCID:21285 Length:1610 Species:Homo sapiens


Alignment Length:193 Identity:34/193 - (17%)
Similarity:66/193 - (34%) Gaps:68/193 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KAMDGIIK---------QCAQVIFGPVC-------DYSLAAVSRITKYFNSQGTPLISVGGSTYD 149
            |.|.|:..         :..:|:||..|       ||.|...::...||.               
Human   448 KVMKGVADSGPLYQYWGRTEKVMFGMACLICNRKEDYPLLGRNKEINYFM--------------- 497

  Fly   150 FEQKKTDCNDEFYMLLRTG---------MLSFETISE--------LTINVMKRHNWSHSIFYYER 197
            :..||...::...:|:..|         ::..|.:::        :::|.:.    .|..||..:
Human   498 YTMKKFLISNSSQVLMYEGLPGYGKSQILMKIEYLAQGKNHRIIAISLNKIS----FHQTFYTIQ 558

  Fly   198 DGQRSVAGMHTCFLMMKSLGKQMRNENMTF--------------AQFPLEPNLTNRTEEMRRE 246
            ....:|.|:.|| ...|.....:||:.||.              .|||:...: :|...::::
Human   559 MFMANVLGLDTC-KHYKERQTNLRNKVMTLLDEKFYCLLNDIFHVQFPISREI-SRMSTLKKQ 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 34/186 (18%)
ADCY10NP_060887.2 CHD 40..214 CDD:143636
AcyC <42..197 CDD:225025
CHD 292..461 CDD:143636 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.