DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and adcy2b

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005170095.1 Gene:adcy2b / 557902 ZFINID:ZDB-GENE-060503-69 Length:1142 Species:Danio rerio


Alignment Length:143 Identity:30/143 - (20%)
Similarity:47/143 - (32%) Gaps:50/143 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSR-------ITKYFNSQG--------- 137
            ::.|....||.:.|.:.||.|....|..   |||:|....       :.|...:.|         
Zfish   805 YELKMIIMLGAVVAYNIIILQTHASILD---DYSMALYKTQQPDRPGVLKDLKTMGSISLFIFFV 866

  Fly   138 TPLISVGGSTY----DF---EQKKTDCNDEFYMLLRTGMLSFETISELT----INVMKRH----- 186
            |.|:....:.|    ||   .:.|.:|.:            .||:..|.    .||:..|     
Zfish   867 TLLVLARQNEYYCRLDFLWRNKFKKECEE------------IETMENLNRVLLENVLPAHVAEHF 919

  Fly   187 ---NWSHSIFYYE 196
               ||.:...|::
Zfish   920 LGRNWKNEDLYHQ 932

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 30/143 (21%)
adcy2bXP_005170095.1 AC_N <80..307 CDD:292831
CYCc 283..486 CDD:214485
Guanylate_cyc 328..512 CDD:278633
DUF1053 542..646 CDD:283888
CYCc 899..1106 CDD:214485 7/34 (21%)
Guanylate_cyc 929..1128 CDD:278633 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.