DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and gucy1b2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_685297.5 Gene:gucy1b2 / 557191 ZFINID:ZDB-GENE-130530-664 Length:757 Species:Danio rerio


Alignment Length:247 Identity:52/247 - (21%)
Similarity:87/247 - (35%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDCVATCREEPARDCEAICDANGRNC--------TIRALVLLPDDNMYQASLPRVLPILKVAEQQ 71
            ||...|.|...||      .||.:.|        .:|::|:|...|:.|:..|.....|.:.||.
Zfish   210 KDKEETMRRMKAR------YANLQLCPRKRSPWELVRSIVMLGQGNLRQSFTPSYPKTLWIEEQA 268

  Fly    72 IRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQ 136
            .  .:..|.||.|:                 .|.::|.....|...|.....|.: |:.:||...
Zfish   269 F--CNAFPFHIVFD-----------------SDLVVKHTGVNIQKFVPGLQTAGI-RLDEYFTIV 313

  Fly   137 GTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHSI---FYYERD 198
            ...:|      ::.:..|...|.:|.:..|..||.....::.|:.:..:..|..|:   .|....
Zfish   314 HPEVI------FNIQSIKKFINSQFVLKTRREMLPEVQQNQPTLKLRGQMMWMESLNCMIYLCSP 372

  Fly   199 GQRSV-----AGMHTCFLMMKSLGKQMRNEN-MTFAQFPLEPNLTNRTEEMR 244
            ..||:     .|:|...:......:.:...| ...|:..|...|..:.||:|
Zfish   373 KLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKKEELR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 39/203 (19%)
gucy1b2XP_685297.5 HNOB 2..163 CDD:285002
CAF-1_p150 <166..277 CDD:288454 19/74 (26%)
HNOBA 269..453 CDD:285003 34/182 (19%)
CYCc 432..618 CDD:214485
Guanylate_cyc 459..642 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.