DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and adcy1a

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001161821.1 Gene:adcy1a / 557026 ZFINID:ZDB-GENE-070705-302 Length:1114 Species:Danio rerio


Alignment Length:230 Identity:45/230 - (19%)
Similarity:75/230 - (32%) Gaps:55/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVLLLVGLVFGPKDCVATC-----REEPARDCEAICDANG-----RNCTIRALVLLP------DD 51
            ||||:..:..|   ||.||     ....:.....:...||     |.|.....|.|.      ..
Zfish   672 LVLLMYSVTQG---CVVTCVPWSLEGNSSISMVTVVTVNGTGVGYRVCKYTPYVFLSCVMASLSV 733

  Fly    52 NMY--QASLPRV--LPILKVAEQQIRSKSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQ 112
            .:|  .:|||::  |.:|.:....:...|.....:...:. |....|..|.::.....::..|.|
Zfish   734 ALYLRVSSLPKILLLLLLNILHTVVMETSGYRKAVGGGFF-HTHGYDPVLAMLLFSGALVLHCRQ 797

  Fly   113 VIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLL------------ 165
            :......||..|..:...:                .|.|:.|.|.....:.||            
Zfish   798 LDLKLRLDYLWATQAEEER----------------DDMERVKLDNKRILFNLLPAHVAQHFLLSN 846

  Fly   166 -RTGMLSFETISELTINVMKRHNWSHSIFYYERDG 199
             |...|.:::.|::.:......|::.  ||.|.||
Zfish   847 PRNMDLYYQSYSQVGVLFASIPNFND--FYIELDG 879

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 32/177 (18%)
adcy1aNP_001161821.1 AC_N <154..285 CDD:292831
CYCc 251..446 CDD:214485
Guanylate_cyc 287..469 CDD:278633
DUF1053 513..601 CDD:283888
CYCc 819..1029 CDD:214485 14/63 (22%)
Guanylate_cyc 852..1048 CDD:278633 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.