DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and npr1b

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_009290669.2 Gene:npr1b / 555911 ZFINID:ZDB-GENE-100805-4 Length:1070 Species:Danio rerio


Alignment Length:208 Identity:49/208 - (23%)
Similarity:89/208 - (42%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NGRNCTIRALVLLPDDNMYQASLPRVLPILKVAEQQIRSK-SLIPSHIDFEWLAH----DTKCDA 95
            |..|..:.|::|...:..|..:.|||.|.|..|..::.:. :|:|.|......|:    |..|..
Zfish    43 NHSNDIVLAVILPQHNTSYPWAWPRVGPALDRAIARVNANPNLLPRHRVRHVFANSEDRDGICSE 107

  Fly    96 SLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDE 160
            |:..:.|:|...:.......||.|||:.:.|...|.::   |.|:|:.|.....|.|.      |
Zfish   108 SMAPLMAVDLKFEHNPWAFIGPGCDYTSSPVGLFTAHW---GLPMITAGAPAVAFLQM------E 163

  Fly   161 FYMLLRTGMLSFETISELTINVMKRHNWS-HSIFYYE--RDGQRSVAGMHTCFLMMKSLGKQMRN 222
            .|..:.....:.:.:.|..:::.:...|: ||:..:.  :.|:|:      |:..::.|..:|..
Zfish   164 IYTSITNTGPTHKKLGEYALHLYRHFGWNQHSLLMFSDTKMGERA------CYFALEGLYTEMHE 222

  Fly   223 ENMTFAQFPLEPN 235
            ||:|......|.|
Zfish   223 ENITTMDLVFEEN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 46/198 (23%)
npr1bXP_009290669.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.