DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ACXA

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster


Alignment Length:117 Identity:26/117 - (22%)
Similarity:42/117 - (35%) Gaps:35/117 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RSKSLIPSHIDFEWLAHDTK-CDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQ 136
            |.|.|   |::.|::.:..: ..:||.|...|..::....|||.....:|        |||....
  Fly    36 RCKEL---HLEEEYMKYKIRLMISSLTVFVPMLILLIVALQVIIWSFTEY--------TKYIYIN 89

  Fly   137 GTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNW 188
            .  :..:|.                 ::|.||:||.....:..|    ||.|
  Fly    90 A--IFDLGS-----------------LILVTGLLSINFFEDFVI----RHRW 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 26/117 (22%)
ACXANP_620475.2 AC_N <42..291 CDD:292831 22/108 (20%)
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.