DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and ACXB

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster


Alignment Length:152 Identity:30/152 - (19%)
Similarity:54/152 - (35%) Gaps:36/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CD---YSLAAV-SRITKY-------FNS-QGTPLIS-VGGSTYDF-------EQKKTDCNDEFYM 163
            ||   |.|..: |::..|       ||. ..|.:|| :.|.:|.|       :...|.|....|:
  Fly   691 CDKNQYELDVINSKLYHYDIVTDNCFNPWVFTDMISLIVGVSYTFARIPFALKMLITCCATVAYL 755

  Fly   164 LLRTGMLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGMHTCFLMMKSLGKQMRNENMTFA 228
            ::.....||......|.....:...:|.              :..|.:::....|:.::|..|..
  Fly   756 VIVFFQYSFIFEHSATTTPFMKAELAHC--------------LRVCMMLLTMYAKERQSEFNTKI 806

  Fly   229 QFPLEPNLTNRTEEMRREIGNK 250
            .|.:..:|..:  :...:|.||
  Fly   807 NFKINQDLQGK--QKAADITNK 826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 27/141 (19%)
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 2/2 (100%)
Nucleotidyl_cyc_III 853..1072 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.