DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and NPR2

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:192 Identity:48/192 - (25%)
Similarity:83/192 - (43%) Gaps:38/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLVLLLVGLVFGPKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDDNM-YQASLPRVLPI 64
            :|||..|.|.|..|                     ..||.|:  .|:||:.|: |..:.|||.|.
Human     7 LLLVAALAGGVRPP---------------------GARNLTL--AVVLPEHNLSYAWAWPRVGPA 48

  Fly    65 LKVAEQQIRSKSLIPSHIDFEWLAHDTK--CDASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVS 127
            :.:|.:.: .::|   .:|..:::.:.:  |...|..:.|:|..:.....::.||.|.|..|:|:
Human    49 VALAVEAL-GRAL---PVDLRFVSSELEGACSEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVA 109

  Fly   128 RITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWS 189
            |...::.   .||::.|.....|..|    ||.:..|:|||. |...:.|..:.:....||:
Human   110 RFASHWR---LPLLTAGAVASGFSAK----NDHYRTLVRTGP-SAPKLGEFVVTLHGHFNWT 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 38/147 (26%)
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556 39/152 (26%)
PK_GC-A_B 521..848 CDD:270944
HNOBA <857..902 CDD:311573
CYCc 881..1065 CDD:214485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.