DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Gycbeta100B

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster


Alignment Length:251 Identity:52/251 - (20%)
Similarity:80/251 - (31%) Gaps:78/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PKDCVATCREEPARDCEAICDANGRNCTIRALVLLPDD-NMYQASLPRVLPILKVAEQQI-RSKS 76
            |...::||   |.......||.:.....:|.|....|| ..|......:..|...|:.|: ..|.
  Fly   252 PSIALSTC---PIAQDSFDCDGDKEQKCLRLLKNKSDDIERYDHVQFLIREINVAAKSQVDAKKD 313

  Fly    77 LIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGPVCDYSL------------AAVSRI 129
            .:|.  |.|:|     |:|.|            .:...|..|..:.|            .||||:
  Fly   314 EVPD--DMEFL-----CEAPL------------ISPATFCKVFPFHLMFDRQMKIVQAGKAVSRV 359

  Fly   130 TKYFNSQGTPLISVGGS-----TYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWS 189
            ......:...||.|..:     ..:||...:..|..:.:..|.|.:|            .||.  
  Fly   360 IPRVAEENCSLIEVVEAIRPHLQLNFENILSHINTIYVLQTRQGAMS------------SRHE-- 410

  Fly   190 HSIFYYERDGQRSVAGMHTCFLMMKSLGKQM---RNENMTFAQFPLEPNLTNRTEE 242
                      ||        ||.:|  |:.|   ..:.:.|..:|...||.:.|::
  Fly   411 ----------QR--------FLRLK--GQMMYIPETDRILFQCYPSVMNLDDLTKK 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 43/216 (20%)
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 31/167 (19%)
CYCc 496..688 CDD:214485
Guanylate_cyc 522..714 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.