DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Adcy1

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_033752.1 Gene:Adcy1 / 432530 MGIID:99677 Length:1118 Species:Mus musculus


Alignment Length:205 Identity:44/205 - (21%)
Similarity:67/205 - (32%) Gaps:66/205 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RNCTIRALVLLPDDN-----MYQASLPRVLPI------LKVAEQQIRSKSLIPSHIDFEWLAHDT 91
            ||| |...:.|.|:|     :..:.|||.:.:      ||..| :|..|..|..|.:...|..| 
Mouse   246 RNC-IEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPE-RIFHKIYIQRHDNVSILFAD- 307

  Fly    92 KCDASLGVIKAMDGIIKQCA--------QVIFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTY 148
                    |....|:..||.        ..:||   .:...|.....:.....|.....|.|.| 
Mouse   308 --------IVGFTGLASQCTAQELVKLLNELFG---KFDELATENHCRRIKILGDCYYCVSGLT- 360

  Fly   149 DFEQKKTDCNDEFYMLLRTGMLSFETI------SELTINVMKRHNWSHSIFYYERDGQRSVAGMH 207
               |.||   |..:..:..|:...:||      :|:.:|:.                    .|:|
Mouse   361 ---QPKT---DHAHCCVEMGLDMIDTITSVAEATEVDLNMR--------------------VGLH 399

  Fly   208 TCFLMMKSLG 217
            |..::...||
Mouse   400 TGRVLCGVLG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 40/197 (20%)
Adcy1NP_033752.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
AC_N <158..291 CDD:292831 14/46 (30%)
CYCc 257..452 CDD:214485 39/193 (20%)
Guanylate_cyc 293..475 CDD:278633 29/156 (19%)
Interaction with calmodulin. /evidence=ECO:0000250 492..519
CYCc 825..1036 CDD:214485
Guanylate_cyc 858..1055 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 1023..1046
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1079..1118
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.