DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and CG31183

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:178 Identity:46/178 - (25%)
Similarity:87/178 - (48%) Gaps:15/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LVLLP---DDNMYQASLPRVLPILKVAEQQIRSKSLI-PSHIDFEWLAHDTKCDASLGVIKAMDG 105
            :.|||   .||.....:|:|||:|::|.:.::....: .||.|.:.::.||.|.:..|.|...: 
  Fly    89 VALLPSVESDNKNDCIMPKVLPVLELAIRHVQRMGFVGGSHFDIQLISRDTFCSSKYGPIGFFE- 152

  Fly   106 IIKQCAQV--IFGPVCDYSLAAVSRITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTG 168
            |..|..:|  :||..|:|.||.:||   |.:....|:::.||:..:|.:|    ::.:..|.|..
  Fly   153 IYTQWPEVNAVFGLPCEYVLAPISR---YADVWQVPVLTTGGNAKEFNKK----SESYSTLTRLK 210

  Fly   169 MLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGMHTCFLMMKSL 216
            ......:..:...::...||:.:...|:.:..: |.|...|||.:.::
  Fly   211 GAQVNNLGNVVRAILNSFNWTRTALIYQNENAK-VKGNSVCFLCLAAI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 46/177 (26%)
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368 46/178 (26%)
ANF_receptor 108..473 CDD:279440 40/159 (25%)
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003
CYCc 917..1108 CDD:214485
Guanylate_cyc 944..1130 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.