DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and Ac76E

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster


Alignment Length:224 Identity:34/224 - (15%)
Similarity:81/224 - (36%) Gaps:76/224 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LKVAEQQIRS---------KSLIPSHIDFEWLAHDTKCD---ASLGVIKAMDGIIK--------- 108
            |||.::::.:         ::::|:|:...:|..:...:   .|...:..|...|.         
  Fly  1062 LKVEQEEVETMRGINKILLENILPAHVATHFLHLERSTELYHESYSCVAVMFASIPNYKEFYDET 1126

  Fly   109 -------QCAQVIFGPVCDY-------SLAAVSRI----TKYFNSQG-TPLISVGGSTYDF-EQK 153
                   :|.:::...:||:       ..:.:.:|    :.|..:.| .|....|.::..| ::|
  Fly  1127 DVNKQGLECLRLLNEIICDFDKLLLKPKFSGIEKIKTIASTYMCASGLRPGKEDGATSRSFADEK 1191

  Fly   154 KTDCND-----EFYMLLRT--GMLSFETISELTINVMKRHN----------------WSHSIFYY 195
            :|:.::     ||.:.|.:  ..::.|:.....:.:...|.                ||:::...
  Fly  1192 RTEEHNVVILVEFAIALMSILDSINRESFQRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVA 1256

  Fly   196 ERDGQRSVAGMHTCFLMMKSLGKQMRNEN 224
            .|        |.:|.:|    |:....||
  Fly  1257 SR--------MDSCGVM----GRLQTTEN 1273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 34/224 (15%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485 31/207 (15%)
Guanylate_cyc 1101..1305 CDD:278633 28/185 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.