DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and CG43373

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster


Alignment Length:156 Identity:29/156 - (18%)
Similarity:52/156 - (33%) Gaps:62/156 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SLAAVSRITKYFNSQGTPL---------ISVGGS---------TYDFEQKKTDCNDEFYMLLRT- 167
            :|..::.:...|...|..:         :.|.||         |..::.::.||  :||:...| 
  Fly  1088 ALIVLTTLLAMFQESGRQMELLQRRRFWLDVNGSISLNDTELNTKMYDAEEPDC--DFYLAYNTF 1150

  Fly   168 ------GMLSFETISELTINVMKRHNWSHSIFYYERDGQRSVAGMHTCFLMMKSLGKQMRNENMT 226
                  .|:|..|...|.| ::|                        ..|::.:.|..|      
  Fly  1151 LLLTLLSMMSCATYQVLRI-LLK------------------------LLLLLLASGSYM------ 1184

  Fly   227 FAQFPLEPNLTNRTEEMRREIGNKHA 252
                ....||.:|:.||.:|:.|:.|
  Fly  1185 ----ACSSNLYSRSREMSQELANEEA 1206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 24/143 (17%)
CG43373NP_001097622.2 AC_N <523..720 CDD:292831
CYCc 686..881 CDD:214485
Guanylate_cyc 722..895 CDD:278633
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485
Guanylate_cyc 1285..1479 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.