DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14877 and CG10738

DIOPT Version :9

Sequence 1:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:167 Identity:40/167 - (23%)
Similarity:59/167 - (35%) Gaps:40/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DTKCD----ASL------GVIKAMDGIIKQCAQVIFGPVCDYSLAAVSR-ITK------YFNSQG 137
            |.|.|    ||:      |||...|..|:     ..|.:|..:....|| :.|      :...||
  Fly   666 DVKLDNMFIASMVADIIRGVIYLHDSPIR-----FHGALCTSNCLVDSRWVVKLTDFGLFAFKQG 725

  Fly   138 TPLISVGGSTYDFEQKKTDCNDEFYM---LLRTGMLSFETISELTINVMKRHNWSHSIFYYERDG 199
                 :..|:.|.:.....|....|.   |||.|.      |.|.:...:...:|..|..||...
  Fly   726 -----IEDSSTDMQHMSAKCLKLLYRAPELLRQGP------SSLVMGTQRGDAYSFGILLYEMHV 779

  Fly   200 QRSVAGMHTCFLMMKSLGKQMRNENMTFAQFPLEPNL 236
            :|...| .|....|:.|.|.::.::..   .|..|:|
  Fly   780 RRGPFG-ETGLTPMQCLQKVLQPQDYL---NPYRPSL 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 40/167 (24%)
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 40/167 (24%)
TyrKc 597..847 CDD:197581 40/167 (24%)
HNOBA <862..907 CDD:285003
CYCc 886..1078 CDD:214485
Guanylate_cyc 913..1099 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.